Klang Valley Plumber Guide
Menu
Get plumbing quotes

Ab Service and Maintenance

Updated 2026-08-30 · 2,775 reviewed · 248 listed · Scored from 171 Google reviews · How we rank ›

4.7(171) 83 composite score See reviews on Google ✓ Google-verified
Water Heater Installation & RepairGeneral Plumbing & RepairsBathroom & Toilet Fitting/RenovationDrain & Pipe UncloggingWater Tank & Pump Services

Google-verified171 Google reviews26 Years of Experience

Ab Service and Maintenance
Location
Usj 14, Subang Jaya
Services
Water Heater Installation & Repair, General Plumbing & Repairs, Bathroom & Toilet Fitting/Renovation
Reviews
171
Ranking
#20 in Water Heater Installation & Repair
Best for
homeowners seeking fast, affordable repairs with same-day or next-day response

Google Business Profile is the source for the business data shown here, last checked 2026-08-30. Details taken from their website were fetched 2026-08-30.

What reviewers think

Most reviewers praise quick, professional work and fair pricing that keeps them returning year after year. Some describe techs as responsive and knowledgeable, though a few have hit recurring problems with plumbing repairs, damage to furniture from chemical spills, and pushback on repeat inspections.

The business offers air-con, plumbing, and bathroom work across the Klang Valley. Their website claims 26 years operating. A handful of older reviews flag quality gaps and poor attitudes when problems resurface, setting them apart from uniformly positive recent feedback.

Praised for
  • fast response and quick job completion
  • reasonable pricing with transparency
  • long-term reliability and customer loyalty
  • friendly and professional technicians
  • fixes resolved on first visit
Watch-outs
  • recurring plumbing issues after repair
  • excessive inspection charges
  • poor technician attitude when questioned
  • damage to customer property during work
  • pricing inconsistency with job quality
fast-responsepunctualfair-pricingskilled-workmanshipfriendly-technicianresponsive-communicationhonest-quotesclean-tidy-workreoccurring-issue-unresolvedleft-mess
Best for: homeowners seeking fast, affordable repairs with same-day or next-day response
Think twice if: you need long-term warranty on plumbing work or your property has surfaces that need protecting during chemical treatments

Strengths

  • quick turnaround on jobs
  • transparent pricing
  • long track record with returning customers
  • responsive to callbacks

Worth knowing

  • One reviewer reported a plumbing issue resurfaced one week after repair; technician charged for a second inspection
  • Another noted AC chemical cleaning stripped paint off furniture; chemical residue left on table surface
  • Long-standing customer reports ACs serviced regularly for 12+ years remain in working order
  • Toilet repairs noted as quick; bathroom ventilation fan repair praised for speed

What reviews say by service

General Plumbing & Repairs
One reviewer's recurring leak issue resurfaced within a week; technician charged for re-inspection
Water Heater Installation & Repair
Water leak repair resolved immediately in one case; no further detail in reviews
Bathroom & Toilet Fitting/Renovation
Toilet repair done quickly; bathroom ventilation fan repair praised for speed and responsibility
Drain & Pipe Unclogging
Clogged toilet solutions mentioned on website but no specific review evidence

How it compares

  • Rated 4.7 against a 4.65 average across the 87 water heater installation & repair businesses listed here.
  • Has more Google reviews than 96% of the businesses in this directory.

How did this business earn its score?

Ranking Method
Star rating 79
Review volume 97
Review recency 100
Review sentiment 61
Profile completeness 100
Verification 30

Rating breakdown

5
151
4
5
3
3
2
1
1
11

Questions people ask

How fast will they respond to my call?
Recent reviews consistently praise fast response and quick job completion, often same day or within hours.
Do they operate on weekends?
Yes, they list seven days of opening hours on their Google profile.
Will they charge me for a second visit if the problem comes back?
One reviewer reported being charged for an inspection fee on a repeat visit for a plumbing issue that recurred one week later.
Request a quote

Similar plumber nearby

Sumon Electrical & Hardware Trading
89

Sumon Electrical & Hardware Trading

4.9(89)✓ Google-verified

Sumon Electrical is a hardware shop that stands out for staying open 24 hours, which draws praise from contractors needing emergency supplies late at night. Stock depth is the real draw: reviewers consistently found hard-to-find items here after striking out elsewhere, and the owner responds quickly to calls, even delaying closing time for urgent requests. The shop serves electricians, plumbers, and DIY enthusiasts in Subang Jaya and USJ. Prices are described as reasonable, and staff are noted as friendly and helpful. No significant complaints appear in recent reviews.

General Plumbing & RepairsWater Heater Installation & RepairDrain & Pipe Unclogging
View profile
MSBS BUILDING MAINTENANCE
67 low data

MSBS BUILDING MAINTENANCE

4.5(32)✓ Google-verified

Most customers praise Mr. Suhaimi's technical skill, honesty about problems, and fair pricing, especially for leak detection and emergency calls. However, a minority report missed appointments, poor follow-up communication, and inconsistent availability that can derail urgent repairs.

Drain & Pipe Unclogging24/7 Emergency PlumberGeneral Plumbing & Repairs
View profile

Own this business? Get featured

Own or market a business here? Ask about featured placement and advertising on this directory. Your message goes straight to the directory team.

Last updated 2026-08-30